Lineage for d3mmia_ (3mmi A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2008039Superfamily a.118.27: DIL domain-like [310601] (1 family) (S)
    Pfam PF01843
  5. 2008040Family a.118.27.1: DIL domains from class V myosins [310651] (6 protein domains)
  6. 2008044Protein Myosin-4 (Myo4p) globular tail [310805] (1 species)
  7. 2008045Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311070] (1 PDB entry)
  8. 2008046Domain d3mmia_: 3mmi A: [305967]

Details for d3mmia_

PDB Entry: 3mmi (more details), 2.3 Å

PDB Description: Crystal structure of the globular tail of Myo4p
PDB Compounds: (A:) Myosin-4

SCOPe Domain Sequences for d3mmia_:

Sequence, based on SEQRES records: (download)

>d3mmia_ a.118.27.1 (A:) Myosin-4 (Myo4p) globular tail {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dllellmdlncytlevtegylkkvnvtevngdnvlgpihvittvvsslvrnglliqsskf
iskvlltvesivmslpkdetmlggifwlsnlsrlpafaanqktlyeanggdekdkltliy
lndlenetlkvfdkiystwlvkfmkhasahieifdmvlneklfknsgdekfaklftflne
fdavlckfqvvdsmhtkifndtlkylnvmlfndlitkcpalnwkygyevdrnierlvswf
epriedvrpnliqiiqavkilqlkisnlnefkllfdfwyalnpaqiqaillkykpankge
agvpneilnylanvikrenlslpgkmeimlsaqfdsaknhlr

Sequence, based on observed residues (ATOM records): (download)

>d3mmia_ a.118.27.1 (A:) Myosin-4 (Myo4p) globular tail {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dllellmdlncytlevtegylkkvnvtevnglgpihvittvvsslvrnglliqsskfisk
vlltvesivmslpkdetmlggifwlsnlsrlpafaanqktlydkltliylndlenetlkv
fdkiystwlvkfmkhasahieifdmvlneklfknsgdekfaklftflnefdavlckfqvv
dsmhtkifndtlkylnvmlfndlitkcpalnwkygyevdrnierlvswfepriedvrpnl
iqiiqavkilqlkisnlnefkllfdfwyalnpaqiqaillkykpagvpneilnylanvik
renlslpgkmeimlsaqfdsaknhlr

SCOPe Domain Coordinates for d3mmia_:

Click to download the PDB-style file with coordinates for d3mmia_.
(The format of our PDB-style files is described here.)

Timeline for d3mmia_:

  • d3mmia_ is new in SCOPe 2.06-stable

View in 3D
Domains from other chains:
(mouse over for more information)
d3mmib_