Lineage for d1fcdb2 (1fcd B:115-255)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2849973Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [51966] (1 species)
    has a smaller C-terminal alpha+beta domain instead the "interface" domain
  7. 2849974Species Chromatium vinosum [TaxId:1049] [51967] (1 PDB entry)
  8. 2849978Domain d1fcdb2: 1fcd B:115-255 [30596]
    Other proteins in same PDB: d1fcda3, d1fcdb3, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2
    complexed with fad, hec
    missing some secondary structures that made up less than one-third of the common domain

Details for d1fcdb2

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution
PDB Compounds: (B:) flavocytochrome c sulfide dehydrogenase (flavin-binding subunit)

SCOPe Domain Sequences for d1fcdb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcdb2 c.3.1.5 (B:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Chromatium vinosum [TaxId: 1049]}
gyseeaaaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvay
ylkahkpmskviildssqtfskqsqfskgwerlygfgtenamiewhpgpdsavvkvdgge
mmvetafgdefkadvinlipp

SCOPe Domain Coordinates for d1fcdb2:

Click to download the PDB-style file with coordinates for d1fcdb2.
(The format of our PDB-style files is described here.)

Timeline for d1fcdb2: