| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [51966] (1 species) has a smaller C-terminal alpha+beta domain instead the "interface" domain |
| Species Chromatium vinosum [TaxId:1049] [51967] (1 PDB entry) |
| Domain d1fcdb2: 1fcd B:115-255 [30596] Other proteins in same PDB: d1fcda3, d1fcdb3, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2 complexed with fad, hec missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 1fcd (more details), 2.53 Å
SCOPe Domain Sequences for d1fcdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fcdb2 c.3.1.5 (B:115-255) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Chromatium vinosum [TaxId: 1049]}
gyseeaaaklphawkageqtailrkqledmadggtvviappaapfrcppgpyerasqvay
ylkahkpmskviildssqtfskqsqfskgwerlygfgtenamiewhpgpdsavvkvdgge
mmvetafgdefkadvinlipp
Timeline for d1fcdb2: