![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
![]() | Domain d3miqh1: 3miq H:2-116 [305956] Other proteins in same PDB: d3miqa_, d3miqb_, d3miqc_, d3miqd_, d3miqh2 automated match to d3ogog_ complexed with ipa |
PDB Entry: 3miq (more details), 2.8 Å
SCOPe Domain Sequences for d3miqh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3miqh1 b.1.1.1 (H:2-116) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrssy edsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtvss
Timeline for d3miqh1: