Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries) |
Domain d3miqg_: 3miq G: [305955] Other proteins in same PDB: d3miqa_, d3miqb_, d3miqc_, d3miqd_, d3miqh2 automated match to d3ogog_ complexed with ipa |
PDB Entry: 3miq (more details), 2.8 Å
SCOPe Domain Sequences for d3miqg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3miqg_ b.1.1.1 (G:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} mqvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrss yedsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtvss
Timeline for d3miqg_: