Lineage for d3miqg_ (3miq G:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2023922Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (33 PDB entries)
  8. 2023966Domain d3miqg_: 3miq G: [305955]
    Other proteins in same PDB: d3miqa_, d3miqb_, d3miqc_, d3miqd_, d3miqh2
    automated match to d3ogog_
    complexed with ipa

Details for d3miqg_

PDB Entry: 3miq (more details), 2.8 Å

PDB Description: Structure of the GFP:GFP-nanobody complex at 2.8 A resolution in P22121
PDB Compounds: (G:) GFP-nanobody

SCOPe Domain Sequences for d3miqg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3miqg_ b.1.1.1 (G:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
mqvqlvesggalvqpggslrlscaasgfpvnrysmrwyrqapgkerewvagmssagdrss
yedsvkgrftisrddarntvylqmnslkpedtavyycnvnvgfeywgqgtqvtvss

SCOPe Domain Coordinates for d3miqg_:

Click to download the PDB-style file with coordinates for d3miqg_.
(The format of our PDB-style files is described here.)

Timeline for d3miqg_: