Lineage for d3miqd_ (3miq D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2939778Protein Green fluorescent protein, GFP [54513] (6 species)
  7. 2939786Species Jellyfish (Aequorea victoria) [TaxId:6100] [54514] (285 PDB entries)
    Uniprot P42212
  8. 2940116Domain d3miqd_: 3miq D: [305952]
    Other proteins in same PDB: d3miqe_, d3miqf_, d3miqg_, d3miqh1, d3miqh2
    automated match to d3st2a_
    complexed with ipa

Details for d3miqd_

PDB Entry: 3miq (more details), 2.8 Å

PDB Description: Structure of the GFP:GFP-nanobody complex at 2.8 A resolution in P22121
PDB Compounds: (D:) Green fluorescent protein

SCOPe Domain Sequences for d3miqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3miqd_ d.22.1.1 (D:) Green fluorescent protein, GFP {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptlvt
tlgygvqcfsrypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynynshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylstqsalskdpnekrdhmvllefvtaagit

SCOPe Domain Coordinates for d3miqd_:

Click to download the PDB-style file with coordinates for d3miqd_.
(The format of our PDB-style files is described here.)

Timeline for d3miqd_: