Lineage for d1fcdb1 (1fcd B:1-114,B:256-327)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67284Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [51966] (1 species)
  7. 67285Species Purple phototrophic bacterium (Chromatium vinosum) [TaxId:1049] [51967] (1 PDB entry)
  8. 67288Domain d1fcdb1: 1fcd B:1-114,B:256-327 [30595]
    Other proteins in same PDB: d1fcda3, d1fcdb3, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2

Details for d1fcdb1

PDB Entry: 1fcd (more details), 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

SCOP Domain Sequences for d1fcdb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fcdb1 c.3.1.5 (B:1-114,B:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum)}
agrkvvvvgggtggataakyikladpsievtliepntdyytcylsneviggdrklesikh
gydglrahgiqvvhdsatgidpdkklvktaggaefgydrcvvapgieliydkieXqragk
iaqiagltndagwcpvdiktfessihkgihvigdasianpmpksgysansqgkvaaaavv
vllkgee

SCOP Domain Coordinates for d1fcdb1:

Click to download the PDB-style file with coordinates for d1fcdb1.
(The format of our PDB-style files is described here.)

Timeline for d1fcdb1: