SCOPe 2.08: Domain d1fcdb1: 1fcd B:1-114,B:256-327

Lineage for d1fcdb1 (1fcd B:1-114,B:256-327)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families)

5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
   duplication: both domains have similar folds and functions
   most members of the family contain common C-terminal alpha+beta domain

6. Protein Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit [51966] (1 species)
   has a smaller C-terminal alpha+beta domain instead the "interface" domain

7. Species Chromatium vinosum [TaxId:1049] [51967] (1 PDB entry)

8. Domain d1fcdb1: 1fcd B:1-114,B:256-327 [30595]
   Other proteins in same PDB: d1fcda3, d1fcdb3, d1fcdc1, d1fcdc2, d1fcdd1, d1fcdd2
   complexed with fad, hec
   missing some secondary structures that made up less than one-third of the common domain

Details for d1fcdb1

PDB Entry: 1fcd, 2.53 Å

PDB Description: the structure of flavocytochrome c sulfide dehydrogenase from a purple phototrophic bacterium chromatium vinosum at 2.5 angstroms resolution

PDB Compounds: (B:) flavocytochrome c sulfide dehydrogenase (flavin-binding subunit)

SCOPe Domain Sequences for d1fcdb1:

Sequence; same for both SEQRES and ATOM records:

>d1fcdb1 c.3.1.5 (B:1-114,B:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Chromatium vinosum [TaxId: 1049]}
agrkvvvvgggtggataakyikladpsievtliepntdyytcylsneviggdrklesikh
gydglrahgiqvvhdsatgidpdkklvktaggaefgydrcvvapgieliydkieXqragk
iaqiagltndagwcpvdiktfessihkgihvigdasianpmpksgysansqgkvaaaavv
vllkgee

Timeline for d1fcdb1:

• d1fcdb1 first appeared (with stable ids) in SCOP 1.55
  
• d1fcdb1 appears in SCOPe 2.07