Lineage for d3mhhb_ (3mhh B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2739463Fold a.301: Sus1-like [310571] (1 superfamily)
    5 helices; articulated hairpin fold
  4. 2739464Superfamily a.301.1: Sus1-like [310603] (1 family) (S)
    Pfam PF10163
    interactions with Sac3, Cdc31 described in PubMed 19328066
  5. 2739465Family a.301.1.1: Sus1-like [310653] (3 proteins)
  6. 2739472Protein Sus1 [310814] (1 species)
  7. 2739473Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [311080] (14 PDB entries)
  8. 2739481Domain d3mhhb_: 3mhh B: [305940]
    automated match to d3fwbc_
    complexed with zn

Details for d3mhhb_

PDB Entry: 3mhh (more details), 2.45 Å

PDB Description: Structure of the SAGA Ubp8/Sgf11/Sus1/Sgf73 DUB module
PDB Compounds: (B:) Protein SUS1

SCOPe Domain Sequences for d3mhhb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mhhb_ a.301.1.1 (B:) Sus1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dtaqlksqiqqylvesgnyelisnelkarllqegwvdkvkdltksemninestnftqils
tvepkalemvsdstretvlkqirefleeivdtq

SCOPe Domain Coordinates for d3mhhb_:

Click to download the PDB-style file with coordinates for d3mhhb_.
(The format of our PDB-style files is described here.)

Timeline for d3mhhb_: