Lineage for d3menc1 (3men C:1-336)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233472Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2233473Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2233820Family d.165.1.0: automated matches [191615] (1 protein)
    not a true family
  6. 2233821Protein automated matches [191124] (7 species)
    not a true protein
  7. 2233824Species Burkholderia pseudomallei [TaxId:320372] [311316] (1 PDB entry)
  8. 2233827Domain d3menc1: 3men C:1-336 [305936]
    Other proteins in same PDB: d3mena2, d3menb2, d3menc2, d3mend2
    automated match to d4zuoa_
    complexed with iod, k, so4, zn

Details for d3menc1

PDB Entry: 3men (more details), 2.2 Å

PDB Description: Crystal structure of acetylpolyamine aminohydrolase from Burkholderia pseudomallei, iodide soak
PDB Compounds: (C:) Acetylpolyamine aminohydrolase

SCOPe Domain Sequences for d3menc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3menc1 d.165.1.0 (C:1-336) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
mltyfhpdqslhhprtyfsrgrmrmpqevperaarlvaaafamgfpvrepddfgiapiaa
vhdthylrfletvhrewkampedwgdeamsnifvrepnalrgvlaqaarhladgscpvge
htwraaywsaqsalaaaaavrdgapaayalcrppghharvdaaggfcylnnaaiaaqalr
arharvavldtdmhhgqgiqeifyarrdvlyvsihgdptnfypavagfddergageglgy
nvnlpmphgsseaaffervddalrelrrfapdalvlslgfdvyrddpqsqvavttdgfgr
lghligalrlptvivqeggyhiesleanarsffggf

SCOPe Domain Coordinates for d3menc1:

Click to download the PDB-style file with coordinates for d3menc1.
(The format of our PDB-style files is described here.)

Timeline for d3menc1: