Lineage for d3md9b_ (3md9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912906Species Yersinia pestis [TaxId:632] [311315] (1 PDB entry)
  8. 2912908Domain d3md9b_: 3md9 B: [305931]
    automated match to d2r7ab_
    complexed with br, gol, so4

Details for d3md9b_

PDB Entry: 3md9 (more details), 1.5 Å

PDB Description: Structure of apo form of a periplasmic heme binding protein
PDB Compounds: (B:) Hemin-binding periplasmic protein hmuT

SCOPe Domain Sequences for d3md9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3md9b_ c.92.2.0 (B:) automated matches {Yersinia pestis [TaxId: 632]}
aerivtiggdvteiayalgagdeivardstsqqpqaaqklpdvgymrtlnaegilamkpt
mllvselaqpslvltqiassgvnvvtvpgqttpesvamkinavatalhqtekgqkliedy
qqrlaavnktplpvkvlfvmshggltpmaagqntaadamiraaggsnamqgfsryrplsq
egviasapdlllittdgvkalgsseniwklpgmaltpagkhkrllvvddmallgfgletp
qvlaqlrekmeqm

SCOPe Domain Coordinates for d3md9b_:

Click to download the PDB-style file with coordinates for d3md9b_.
(The format of our PDB-style files is described here.)

Timeline for d3md9b_: