SCOPe 2.08: Domain d3ma4b2: 3ma4 B:92-241

Lineage for d3ma4b2 (3ma4 B:92-241)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
   similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition

7. Species Human (Homo sapiens) [TaxId:9606] [69034] (5 PDB entries)

8. Domain d3ma4b2: 3ma4 B:92-241 [305929]
   Other proteins in same PDB: d3ma4a1, d3ma4b1
   automated match to d4jzqa2
   mutant

Details for d3ma4b2

PDB Entry: 3ma4, 1.74 Å

PDB Description: Crystal structure analysis of M32A mutant of human CLIC1

PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3ma4b2:

Sequence, based on SEQRES records:

>d3ma4b2 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records):

>d3ma4b2 a.45.1.1 (B:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplprk
fldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefastcpdd
eeielayeqvakalk

Timeline for d3ma4b2:

• d3ma4b2 first appeared in SCOPe 2.06
  
• d3ma4b2 appears in SCOPe 2.07