![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein Chloride intracellular channel 1 (clic1) [69033] (1 species) similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition |
![]() | Species Human (Homo sapiens) [TaxId:9606] [69034] (5 PDB entries) |
![]() | Domain d3ma4a2: 3ma4 A:92-241 [305927] Other proteins in same PDB: d3ma4a1, d3ma4b1 automated match to d4jzqa2 mutant |
PDB Entry: 3ma4 (more details), 1.74 Å
SCOPe Domain Sequences for d3ma4a2:
Sequence, based on SEQRES records: (download)
>d3ma4a2 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls nayareefastcpddeeielayeqvakalk
>d3ma4a2 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee vdrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefast cpddeeielayeqvakalk
Timeline for d3ma4a2: