Lineage for d3ma4a2 (3ma4 A:92-241)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2712833Protein Chloride intracellular channel 1 (clic1) [69033] (1 species)
    similar to class theta enzymes; the N-domain undergoes a redox-controlled structural transition
  7. 2712834Species Human (Homo sapiens) [TaxId:9606] [69034] (5 PDB entries)
  8. 2712839Domain d3ma4a2: 3ma4 A:92-241 [305927]
    Other proteins in same PDB: d3ma4a1, d3ma4b1
    automated match to d4jzqa2
    mutant

Details for d3ma4a2

PDB Entry: 3ma4 (more details), 1.74 Å

PDB Description: Crystal structure analysis of M32A mutant of human CLIC1
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3ma4a2:

Sequence, based on SEQRES records: (download)

>d3ma4a2 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddeeielayeqvakalk

Sequence, based on observed residues (ATOM records): (download)

>d3ma4a2 a.45.1.1 (A:92-241) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefast
cpddeeielayeqvakalk

SCOPe Domain Coordinates for d3ma4a2:

Click to download the PDB-style file with coordinates for d3ma4a2.
(The format of our PDB-style files is described here.)

Timeline for d3ma4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ma4a1