Lineage for d3ma4a1 (3ma4 A:6-91)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2455315Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2455316Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2457558Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2457559Protein automated matches [190056] (171 species)
    not a true protein
  7. 2458070Species Human (Homo sapiens) [TaxId:9606] [188013] (108 PDB entries)
  8. 2458125Domain d3ma4a1: 3ma4 A:6-91 [305926]
    Other proteins in same PDB: d3ma4a2, d3ma4b2
    automated match to d3o3ta1
    mutant

Details for d3ma4a1

PDB Entry: 3ma4 (more details), 1.74 Å

PDB Description: Crystal structure analysis of M32A mutant of human CLIC1
PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d3ma4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ma4a1 c.47.1.0 (A:6-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqvelfvkagsdgakigncpfsqrlfavlwlkgvtfnvttvdtkrrtetvqklcpggqlp
fllygtevhtdtnkieefleavlcpp

SCOPe Domain Coordinates for d3ma4a1:

Click to download the PDB-style file with coordinates for d3ma4a1.
(The format of our PDB-style files is described here.)

Timeline for d3ma4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ma4a2