Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication parallel beta-sheet of 6 strands, order 213456 |
Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) Similar in architecture to the superfamily II but partly differs in topology |
Family c.93.1.0: automated matches [191439] (1 protein) not a true family |
Protein automated matches [190646] (77 species) not a true protein |
Species Escherichia coli [TaxId:511145] [311314] (3 PDB entries) |
Domain d3ma0c_: 3ma0 C: [305925] Other proteins in same PDB: d3ma0a2 automated match to d4rwea_ complexed with xyp |
PDB Entry: 3ma0 (more details), 2.2 Å
SCOPe Domain Sequences for d3ma0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ma0c_ c.93.1.0 (C:) automated matches {Escherichia coli [TaxId: 511145]} evkigmaiddlrlerwqkdrdifvkkaeslgakvfvqsangneetqmsqienminrgvdv lviipyngqvlsnvvkeakqegikvlaydrmindadidfyisfdnekvgelqakalvdiv pqgnyflmggspvdnnaklfragqmkvlkpyvdsgkikvvgdqwvdgwlpenalkimena ltannnkidavvasndataggaiqalsaqglsgkvaisgqdadlagikriaagtqtmtvy kpitllantaaeiavelgngqepkadttlnnglkdvpsrlltpidvnknnikdtvikdgf hkesel
Timeline for d3ma0c_: