Lineage for d3ma0c_ (3ma0 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913385Species Escherichia coli [TaxId:511145] [311314] (3 PDB entries)
  8. 2913388Domain d3ma0c_: 3ma0 C: [305925]
    Other proteins in same PDB: d3ma0a2
    automated match to d4rwea_
    complexed with xyp

Details for d3ma0c_

PDB Entry: 3ma0 (more details), 2.2 Å

PDB Description: closed liganded crystal structure of xylose binding protein from escherichia coli
PDB Compounds: (C:) D-xylose-binding periplasmic protein

SCOPe Domain Sequences for d3ma0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ma0c_ c.93.1.0 (C:) automated matches {Escherichia coli [TaxId: 511145]}
evkigmaiddlrlerwqkdrdifvkkaeslgakvfvqsangneetqmsqienminrgvdv
lviipyngqvlsnvvkeakqegikvlaydrmindadidfyisfdnekvgelqakalvdiv
pqgnyflmggspvdnnaklfragqmkvlkpyvdsgkikvvgdqwvdgwlpenalkimena
ltannnkidavvasndataggaiqalsaqglsgkvaisgqdadlagikriaagtqtmtvy
kpitllantaaeiavelgngqepkadttlnnglkdvpsrlltpidvnknnikdtvikdgf
hkesel

SCOPe Domain Coordinates for d3ma0c_:

Click to download the PDB-style file with coordinates for d3ma0c_.
(The format of our PDB-style files is described here.)

Timeline for d3ma0c_: