Lineage for d3lzrb_ (3lzr B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2767114Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) (S)
    Pfam PF10634
  5. 2767132Family b.1.33.0: automated matches [310673] (1 protein)
    not a true family
  6. 2767133Protein automated matches [310872] (3 species)
    not a true protein
  7. 2767134Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries)
  8. 2767152Domain d3lzrb_: 3lzr B: [305920]
    automated match to d2o6cb_
    complexed with cu, mn, so4

Details for d3lzrb_

PDB Entry: 3lzr (more details), 2.73 Å

PDB Description: Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 2.73 A at pH 9 and Manganese peak wavelength (1.893 A)
PDB Compounds: (B:) P19 protein

SCOPe Domain Sequences for d3lzrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lzrb_ b.1.33.0 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

SCOPe Domain Coordinates for d3lzrb_:

Click to download the PDB-style file with coordinates for d3lzrb_.
(The format of our PDB-style files is described here.)

Timeline for d3lzrb_: