SCOPe 2.06: Domain d3lzra_: 3lzr A:

Lineage for d3lzra_ (3lzr A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (2 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:354242] [311313] (8 PDB entries)

8. Domain d3lzra_: 3lzr A: [305919]
   automated match to d2o6cb_
   complexed with cu, mn, so4

Details for d3lzra_

PDB Entry: 3lzr, 2.73 Å

PDB Description: Crystal Structure Analysis of Manganese treated P19 protein from Campylobacter jejuni at 2.73 A at pH 9 and Manganese peak wavelength (1.893 A)

PDB Compounds: (A:) P19 protein

SCOPe Domain Sequences for d3lzra_:

Sequence; same for both SEQRES and ATOM records:

>d3lzra_ b.1.33.0 (A:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

Timeline for d3lzra_:

• d3lzra_ is new in SCOPe 2.06-stable
  
• d3lzra_ appears in SCOPe 2.07
  
• d3lzra_ appears in the current release, SCOPe 2.08