SCOPe 2.08: Domain d3lzpa1: 3lzp A:2-159

Lineage for d3lzpa1 (3lzp A:2-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families)
   Pfam PF10634

5. Family b.1.33.0: automated matches [310673] (1 protein)
   not a true family

6. Protein automated matches [310872] (3 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries)

8. Domain d3lzpa1: 3lzp A:2-159 [305913]
   Other proteins in same PDB: d3lzpa2
   automated match to d2o6cb_
   complexed with cu, so4

Details for d3lzpa1

PDB Entry: 3lzp, 1.65 Å

PDB Description: Crystal Structure Analysis of the 'as-isolated' P19 protein from Campylobacter jejuni at 1.65 A at pH 9.0

PDB Compounds: (A:) P19 protein

SCOPe Domain Sequences for d3lzpa1:

Sequence; same for both SEQRES and ATOM records:

>d3lzpa1 b.1.33.0 (A:2-159) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk

Timeline for d3lzpa1:

• d3lzpa1 first appeared in SCOPe 2.06
  
• d3lzpa1 appears in SCOPe 2.07