| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
| Family b.1.33.0: automated matches [310673] (1 protein) not a true family |
| Protein automated matches [310872] (3 species) not a true protein |
| Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries) |
| Domain d3lznb_: 3lzn B: [305908] automated match to d2o6cb_ complexed with so4, zn |
PDB Entry: 3lzn (more details), 1.59 Å
SCOPe Domain Sequences for d3lznb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lznb_ b.1.33.0 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]}
gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf
wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi
snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk
Timeline for d3lznb_: