![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.33: Membrane antigen precursor-like [310605] (2 families) ![]() Pfam PF10634 |
![]() | Family b.1.33.0: automated matches [310673] (1 protein) not a true family |
![]() | Protein automated matches [310872] (3 species) not a true protein |
![]() | Species Campylobacter jejuni [TaxId:354242] [311313] (11 PDB entries) |
![]() | Domain d3lzlb_: 3lzl B: [305906] automated match to d2o6cb_ complexed with cu, so4 |
PDB Entry: 3lzl (more details), 1.45 Å
SCOPe Domain Sequences for d3lzlb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lzlb_ b.1.33.0 (B:) automated matches {Campylobacter jejuni [TaxId: 354242]} gevpigdpkelngmeiaavylqpiemeprgidlaasladihleadihalknnpngfpegf wmpyltiayelkntdtgaikrgtlmpmvaddgphyganiamekdkkggfgvgnyeltfyi snpekqgfgrhvdeetgvgkwfepfkvdykfkytgtpk
Timeline for d3lzlb_: