Lineage for d3lyjk_ (3lyj K:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775864Domain d3lyjk_: 3lyj K: [305903]
    Other proteins in same PDB: d3lyjb_, d3lyjd_, d3lyjf_, d3lyjh_, d3lyjj_, d3lyjl_
    automated match to d3gbna_
    complexed with nag

Details for d3lyjk_

PDB Entry: 3lyj (more details), 2.87 Å

PDB Description: Crystal structure of the hemagglutinin of 2009 H1N1 influenza virus
PDB Compounds: (K:) Hemagglutinin

SCOPe Domain Sequences for d3lyjk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lyjk_ b.19.1.2 (K:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrni

SCOPe Domain Coordinates for d3lyjk_:

Click to download the PDB-style file with coordinates for d3lyjk_.
(The format of our PDB-style files is described here.)

Timeline for d3lyjk_: