Lineage for d3lyjh_ (3lyj H:)

  1. Root: SCOPe 2.06
  2. 2265466Class h: Coiled coil proteins [57942] (7 folds)
  3. 2266922Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 2266923Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 2266924Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 2266925Protein Influenza hemagglutinin (stalk) [58066] (12 species)
    trimer
  7. 2266962Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries)
  8. 2267212Domain d3lyjh_: 3lyj H: [305900]
    Other proteins in same PDB: d3lyja_, d3lyjc_, d3lyje_, d3lyjg_, d3lyji_, d3lyjk_
    automated match to d3gbmb_
    complexed with nag

Details for d3lyjh_

PDB Entry: 3lyj (more details), 2.87 Å

PDB Description: Crystal structure of the hemagglutinin of 2009 H1N1 influenza virus
PDB Compounds: (H:) Hemagglutinin

SCOPe Domain Sequences for d3lyjh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lyjh_ h.3.1.1 (H:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky

SCOPe Domain Coordinates for d3lyjh_:

Click to download the PDB-style file with coordinates for d3lyjh_.
(The format of our PDB-style files is described here.)

Timeline for d3lyjh_: