Lineage for d3lyjg_ (3lyj G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2775522Protein Hemagglutinin [49824] (22 species)
    includes rudiment esterase domain
  7. 2775631Species Influenza A virus, different strains [TaxId:11320] [49825] (131 PDB entries)
  8. 2775862Domain d3lyjg_: 3lyj G: [305899]
    Other proteins in same PDB: d3lyjb_, d3lyjd_, d3lyjf_, d3lyjh_, d3lyjj_, d3lyjl_
    automated match to d3gbna_
    complexed with nag

Details for d3lyjg_

PDB Entry: 3lyj (more details), 2.87 Å

PDB Description: Crystal structure of the hemagglutinin of 2009 H1N1 influenza virus
PDB Compounds: (G:) Hemagglutinin

SCOPe Domain Sequences for d3lyjg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lyjg_ b.19.1.2 (G:) Hemagglutinin {Influenza A virus, different strains [TaxId: 11320]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrni

SCOPe Domain Coordinates for d3lyjg_:

Click to download the PDB-style file with coordinates for d3lyjg_.
(The format of our PDB-style files is described here.)

Timeline for d3lyjg_: