Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) |
Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
Protein Influenza hemagglutinin (stalk) [58066] (12 species) trimer |
Species Influenza A virus, different strains [TaxId:11320] [58067] (127 PDB entries) |
Domain d3lyjb_: 3lyj B: [305894] Other proteins in same PDB: d3lyja_, d3lyjc_, d3lyje_, d3lyjg_, d3lyji_, d3lyjk_ automated match to d3gbmb_ complexed with nag |
PDB Entry: 3lyj (more details), 2.87 Å
SCOPe Domain Sequences for d3lyjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lyjb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky
Timeline for d3lyjb_: