Lineage for d3lyjb_ (3lyj B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3041028Species Influenza A virus, different strains [TaxId:11320] [58067] (150 PDB entries)
  8. 3041281Domain d3lyjb_: 3lyj B: [305894]
    Other proteins in same PDB: d3lyja_, d3lyjc_, d3lyje_, d3lyjg_, d3lyji_, d3lyjk_
    automated match to d3gbmb_
    complexed with nag

Details for d3lyjb_

PDB Entry: 3lyj (more details), 2.87 Å

PDB Description: Crystal structure of the hemagglutinin of 2009 H1N1 influenza virus
PDB Compounds: (B:) Hemagglutinin

SCOPe Domain Sequences for d3lyjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lyjb_ h.3.1.1 (B:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]}
glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadlkstqnaideitnkvnsviekmn
tqftavgkefnhlekrienlnkkvddgfldiwtynaellvllenertldyhdsnvknlye
kvrsqlknnakeigngcfefyhkcdntcmesvkngtydypky

SCOPe Domain Coordinates for d3lyjb_:

Click to download the PDB-style file with coordinates for d3lyjb_.
(The format of our PDB-style files is described here.)

Timeline for d3lyjb_: