Lineage for d3lyfc_ (3lyf C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016999Fold a.299: Tenuivirus/Phlebovirus nucleocapsid protein-like [310560] (1 superfamily)
  4. 2017000Superfamily a.299.1: Tenuivirus/Phlebovirus nucleocapsid protein [310587] (1 family) (S)
    Pfam PF05733
  5. 2017001Family a.299.1.1: Phlebovirus nucleocapsid protein [310634] (3 protein domains)
  6. 2017002Protein Rift Valley fever virus (RVFV) N protein [310764] (1 species)
  7. 2017003Species Rift Valley fever virus [TaxId:11588] [311019] (6 PDB entries)
  8. 2017009Domain d3lyfc_: 3lyf C: [305891]
    complexed with gol

Details for d3lyfc_

PDB Entry: 3lyf (more details), 1.93 Å

PDB Description: Crystal Structure of the Rift Valley Fever Virus Nucleocapsid Protein
PDB Compounds: (C:) nucleocapsid protein

SCOPe Domain Sequences for d3lyfc_:

Sequence, based on SEQRES records: (download)

>d3lyfc_ a.299.1.1 (C:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]}
mdnyqelaiqfaaqavdrneieqwvrefayqgfdarrviellkqyggadwekdakkmivl
altrgnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalv
vlsewlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvi
npnlrgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqa
yktaa

Sequence, based on observed residues (ATOM records): (download)

>d3lyfc_ a.299.1.1 (C:) Rift Valley fever virus (RVFV) N protein {Rift Valley fever virus [TaxId: 11588]}
mdnyqelaiqfaaqaeieqwvrefayqgfdarrviellkqyggadwekdakkmivlaltr
gnkprrmmmkmskegkatvealinkyklkegnpsrdeltlsrvaaalagrtcqalvvlse
wlpvtgttmdglspayprhmmhpsfagmvdpslpgdylraildahslyllqfsrvinpnl
rgrtkeevaatftqpmnaavnsnfishekrreflkafglvdsngkpsaavmaaaqaykta
a

SCOPe Domain Coordinates for d3lyfc_:

Click to download the PDB-style file with coordinates for d3lyfc_.
(The format of our PDB-style files is described here.)

Timeline for d3lyfc_:

  • d3lyfc_ is new in SCOPe 2.06-stable