Lineage for d1dxlc1 (1dxl C:4-152,C:276-347)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309374Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 309375Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 309632Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (11 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 309649Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 309665Species Garden pea (Pisum sativum) [TaxId:3888] [51965] (1 PDB entry)
  8. 309670Domain d1dxlc1: 1dxl C:4-152,C:276-347 [30589]
    Other proteins in same PDB: d1dxla3, d1dxlb3, d1dxlc3, d1dxld3

Details for d1dxlc1

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum

SCOP Domain Sequences for d1dxlc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxlc1 c.3.1.5 (C:4-152,C:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum)}
sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
seisvdtiegentvvkgkhiiiatgsdvkXgrtpftsglnldkigvetdklgrilvnerf
stnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvd

SCOP Domain Coordinates for d1dxlc1:

Click to download the PDB-style file with coordinates for d1dxlc1.
(The format of our PDB-style files is described here.)

Timeline for d1dxlc1: