![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
![]() | Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) ![]() |
![]() | Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10) |
![]() | Protein Argonaute-2 [310718] (1 species) Pfam PF16487 |
![]() | Species Human (Homo sapiens) [TaxId:9606] [310964] (12 PDB entries) |
![]() | Domain d3lukb_: 3luk B: [305886] automated match to d3luha_ complexed with gol, po4 |
PDB Entry: 3luk (more details), 1.7 Å
SCOPe Domain Sequences for d3lukb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lukb_ c.44.3.1 (B:) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]} kqfhtgieikvwaiacfapqrqctevhlksfteqlrkisrdagmpiqgqpcfckyaqgad svepmfrhlkntyaglqlvvvilpgktpvyaevkrvgdtvlgmatqcvqmknvqrttpqt lsnlclkinvklg
Timeline for d3lukb_: