Lineage for d3lujc_ (3luj C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2875028Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) (S)
  5. 2875029Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins)
    PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10)
  6. 2875043Protein Argonaute-2 [310718] (1 species)
    Pfam PF16487
  7. 2875044Species Human (Homo sapiens) [TaxId:9606] [310964] (12 PDB entries)
  8. 2875056Domain d3lujc_: 3luj C: [305884]
    automated match to d3luha_
    protein/RNA complex; complexed with u5p

Details for d3lujc_

PDB Entry: 3luj (more details), 1.8 Å

PDB Description: crystal structure of mid domain from hago2 in complex with ump
PDB Compounds: (C:) Protein argonaute-2

SCOPe Domain Sequences for d3lujc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lujc_ c.44.3.1 (C:) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]}
qfhtgieikvwaiacfapqrqctevhlksfteqlrkisrdagmpiqgqpcfckyaqgads
vepmfrhlkntyaglqlvvvilpgktpvyaevkrvgdtvlgmatqcvqmknvqrttpqtl
snlclkinvklg

SCOPe Domain Coordinates for d3lujc_:

Click to download the PDB-style file with coordinates for d3lujc_.
(The format of our PDB-style files is described here.)

Timeline for d3lujc_: