Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies) 3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.44.3: PIWI domain N-terminal-like [310581] (2 families) |
Family c.44.3.1: PIWI domain N-terminal [310609] (4 proteins) PubMed 15565169 notes that both halves of PIWI are usually a single evolutionary unit; however, fragments have been characterized separately. The C-terminal half is (c.55.3.10) |
Protein Argonaute-2 [310718] (1 species) Pfam PF16487 |
Species Human (Homo sapiens) [TaxId:9606] [310964] (12 PDB entries) |
Domain d3lujc_: 3luj C: [305884] automated match to d3luha_ protein/RNA complex; complexed with u5p |
PDB Entry: 3luj (more details), 1.8 Å
SCOPe Domain Sequences for d3lujc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lujc_ c.44.3.1 (C:) Argonaute-2 {Human (Homo sapiens) [TaxId: 9606]} qfhtgieikvwaiacfapqrqctevhlksfteqlrkisrdagmpiqgqpcfckyaqgads vepmfrhlkntyaglqlvvvilpgktpvyaevkrvgdtvlgmatqcvqmknvqrttpqtl snlclkinvklg
Timeline for d3lujc_: