Lineage for d1dxlb2 (1dxl B:153-275)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 67065Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 67066Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 67238Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 67246Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 67262Species Garden pea (Pisum sativum) [TaxId:3888] [51965] (1 PDB entry)
  8. 67266Domain d1dxlb2: 1dxl B:153-275 [30588]
    Other proteins in same PDB: d1dxla3, d1dxlb3, d1dxlc3, d1dxld3

Details for d1dxlb2

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum

SCOP Domain Sequences for d1dxlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxlb2 c.3.1.5 (B:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum)}
slpgvtidekkivsstgalalseipkklvvigagyiglemgsvwgrigsevtvvefasei
vptmdaeirkqfqrslekqgmkfklktkvvgvdtsgdgvkltvepsaggeqtiieadvvl
vsa

SCOP Domain Coordinates for d1dxlb2:

Click to download the PDB-style file with coordinates for d1dxlb2.
(The format of our PDB-style files is described here.)

Timeline for d1dxlb2: