![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
![]() | Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
![]() | Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
![]() | Protein automated matches [191142] (5 species) not a true protein |
![]() | Species Crassostrea gigas [TaxId:29159] [226087] (2 PDB entries) |
![]() | Domain d3ltxd_: 3ltx D: [305869] automated match to d4n1yb_ |
PDB Entry: 3ltx (more details), 2.6 Å
SCOPe Domain Sequences for d3ltxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ltxd_ a.123.1.0 (D:) automated matches {Crassostrea gigas [TaxId: 29159]} qtvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdl slsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaa vseqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnv rhvpavllllthirqagergiaffqrlksegvvtfcdllkemldaq
Timeline for d3ltxd_: