Lineage for d3ltxc_ (3ltx C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729962Species Crassostrea gigas [TaxId:29159] [226087] (2 PDB entries)
  8. 2729965Domain d3ltxc_: 3ltx C: [305868]
    automated match to d4n1yb_

Details for d3ltxc_

PDB Entry: 3ltx (more details), 2.6 Å

PDB Description: Crystal Structure of the Pacific Oyster Estrogen Receptor Ligand Binding Domain
PDB Compounds: (C:) Estrogen receptor

SCOPe Domain Sequences for d3ltxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ltxc_ a.123.1.0 (C:) automated matches {Crassostrea gigas [TaxId: 29159]}
tvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdls
lsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaav
seqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnvr
hvpavllllthirqagergiaffqrlksegvvtfcdllkemlda

SCOPe Domain Coordinates for d3ltxc_:

Click to download the PDB-style file with coordinates for d3ltxc_.
(The format of our PDB-style files is described here.)

Timeline for d3ltxc_: