SCOPe 2.07: Domain d3ltxc_: 3ltx C:

Lineage for d3ltxc_ (3ltx C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.0: automated matches [191623] (1 protein)
   not a true family

6. Protein automated matches [191142] (6 species)
   not a true protein

7. Species Crassostrea gigas [TaxId:29159] [226087] (2 PDB entries)

8. Domain d3ltxc_: 3ltx C: [305868]
   automated match to d4n1yb_

Details for d3ltxc_

PDB Entry: 3ltx, 2.6 Å

PDB Description: Crystal Structure of the Pacific Oyster Estrogen Receptor Ligand Binding Domain

PDB Compounds: (C:) Estrogen receptor

SCOPe Domain Sequences for d3ltxc_:

Sequence; same for both SEQRES and ATOM records:

>d3ltxc_ a.123.1.0 (C:) automated matches {Crassostrea gigas [TaxId: 29159]}
tvtilqalnkaalpvleshhnhgqpptkvhllnslvklaerelvhlinwaknvpgytdls
lsdqvhlieccwmellllncafrsiehggkslafapdlvldrsswstvemteifeqvaav
seqmmqnhlhkdellllqamvlvnaevrrlasynqifnmqqslldaivdtaqkyhpdnvr
hvpavllllthirqagergiaffqrlksegvvtfcdllkemlda

Timeline for d3ltxc_:

• d3ltxc_ first appeared in SCOPe 2.06