SCOPe 2.08: Domain d3lpqa_: 3lpq A:

Lineage for d3lpqa_ (3lpq A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.97: Iron-sulfur cluster-binding zinc finger CDGSH type [310565] (1 superfamily)
   Fe-S binding region and beta cap

4. Superfamily g.97.1: Iron-sulfur cluster-binding zinc finger CDGSH type [310593] (2 families)
   Pfam PF09360; PubMed 17766440

5. Family g.97.1.1: Outer mitochondrial membrane protein mitoNEET-like [310640] (2 proteins)

6. Protein automated matches [310858] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [311238] (13 PDB entries)

8. Domain d3lpqa_: 3lpq A: [305863]
   automated match to d2qh7b_
   complexed with fes

Details for d3lpqa_

PDB Entry: 3lpq, 1.7 Å

PDB Description: Human MitoNEET with 2Fe-2S Coordinating Ligand His 87 Replaced With Cys

PDB Compounds: (A:) CDGSH iron sulfur domain-containing protein 1

SCOPe Domain Sequences for d3lpqa_:

Sequence; same for both SEQRES and ATOM records:

>d3lpqa_ g.97.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rfyvkdhrnkaminlhiqkdnpkivhafdmedlgdkavycrcwrskkfpfcdgactkhne
etgdnvgpliikkke

Timeline for d3lpqa_:

• d3lpqa_ first appeared in SCOPe 2.06
  
• d3lpqa_ appears in SCOPe 2.07