Lineage for d1dxla2 (1dxl A:153-275)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. Protein Dihydrolipoamide dehydrogenase, middle domain [418939] (7 species)
  7. Species Pea (Pisum sativum) [TaxId:3888] [419387] (1 PDB entry)
  8. Domain d1dxla2: 1dxl A:153-275 [30586]
    Other proteins in same PDB: d1dxla1, d1dxla3, d1dxlb1, d1dxlb3, d1dxlc1, d1dxlc3, d1dxld1, d1dxld3
    complexed with fad

Details for d1dxla2

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum
PDB Compounds: (A:) dihydrolipoamide dehydrogenase

SCOPe Domain Sequences for d1dxla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase, middle domain {Pea (Pisum sativum) [TaxId: 3888]}
slpgvtidekkivsstgalalseipkklvvigagyiglemgsvwgrigsevtvvefasei
vptmdaeirkqfqrslekqgmkfklktkvvgvdtsgdgvkltvepsaggeqtiieadvvl
vsa

SCOPe Domain Coordinates for d1dxla2 are not available.

Timeline for d1dxla2:

Domains from same chain:
(mouse over for more information)
d1dxla1, d1dxla3
Domains from other chains:
(mouse over for more information)
d1dxlb1, d1dxlb2, d1dxlb3, d1dxlc1, d1dxlc2, d1dxlc3, d1dxld1, d1dxld2, d1dxld3