| Class b: All beta proteins [48724] (177 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (7 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries) |
| Domain d3lppd1: 3lpp D:34-297 [305859] Other proteins in same PDB: d3lppa2, d3lppa3, d3lppa4, d3lppa5, d3lppb2, d3lppb3, d3lppb4, d3lppc2, d3lppc3, d3lppc4, d3lppc5, d3lppd2, d3lppd3, d3lppd4 automated match to d2qlya1 complexed with bma, cl, ktl, nag, peg, trs |
PDB Entry: 3lpp (more details), 2.15 Å
SCOPe Domain Sequences for d3lppd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lppd1 b.30.5.0 (D:34-297) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmtttsigv
eaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkeftgptvs
dtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiygigeqvh
krfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsnameifi
qptpivtyrvtggildfyillgdt
Timeline for d3lppd1: