Lineage for d3lppc2 (3lpp C:298-678)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832813Species Human (Homo sapiens) [TaxId:9606] [226772] (2 PDB entries)
  8. 2832816Domain d3lppc2: 3lpp C:298-678 [305855]
    Other proteins in same PDB: d3lppa1, d3lppa3, d3lppa4, d3lppa5, d3lppb1, d3lppb3, d3lppb4, d3lppc1, d3lppc3, d3lppc4, d3lppc5, d3lppd1, d3lppd3, d3lppd4
    automated match to d2qlya2
    complexed with bma, cl, ktl, nag, peg, trs

Details for d3lppc2

PDB Entry: 3lpp (more details), 2.15 Å

PDB Description: crystal complex of n-terminal sucrase-isomaltase with kotalanol
PDB Compounds: (C:) Sucrase-isomaltase

SCOPe Domain Sequences for d3lppc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lppc2 c.1.8.0 (C:298-678) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqqyqqlvglpampaywnlgfqlsrwnyksldvvkevvrrnreagipfdtqvtdid
ymedkkdftydqvafnglpqfvqdlhdhgqkyviildpaisigrrangttyatyergntq
hvwinesdgstpiigevwpgltvypdftnpncidwwanecsifhqevqydglwidmnevs
sfiqgstkgcnvnklnyppftpdildklmyskticmdavqnwgkqydvhslygysmaiat
eqavqkvfpnkrsfiltrstfagsgrhaahwlgdntasweqmewsitgmlefslfgiplv
gadicgfvaetteelcrrwmqlgafypfsrnhnsdgyehqdpaffgqnsllvkssrqylt
irytllpflytlfykahvfge

SCOPe Domain Coordinates for d3lppc2:

Click to download the PDB-style file with coordinates for d3lppc2.
(The format of our PDB-style files is described here.)

Timeline for d3lppc2: