Lineage for d3lppb4 (3lpp B:761-898)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089028Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2089029Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2089076Family b.150.1.0: automated matches [310671] (1 protein)
    not a true family
  6. 2089077Protein automated matches [310870] (1 species)
    not a true protein
  7. 2089078Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries)
  8. 2089086Domain d3lppb4: 3lpp B:761-898 [305853]
    Other proteins in same PDB: d3lppa1, d3lppa2, d3lppa3, d3lppa5, d3lppb1, d3lppb2, d3lppb3, d3lppc1, d3lppc2, d3lppc3, d3lppc5, d3lppd1, d3lppd2, d3lppd3
    automated match to d2qlya4
    complexed with bma, cl, ktl, nag, peg, trs

Details for d3lppb4

PDB Entry: 3lpp (more details), 2.15 Å

PDB Description: crystal complex of n-terminal sucrase-isomaltase with kotalanol
PDB Compounds: (B:) Sucrase-isomaltase

SCOPe Domain Sequences for d3lppb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lppb4 b.150.1.0 (B:761-898) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdtiqngnyilytfsv
snntldivcthssyqegttlafqtvkilgltdsvtevrvaennqpmnahsnftydasnqv
lliadlklnlgrnfsvqw

SCOPe Domain Coordinates for d3lppb4:

Click to download the PDB-style file with coordinates for d3lppb4.
(The format of our PDB-style files is described here.)

Timeline for d3lppb4: