Lineage for d3lppb1 (3lpp B:30-297)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2391115Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2391261Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2391750Family b.30.5.0: automated matches [227145] (1 protein)
    not a true family
  6. 2391751Protein automated matches [226849] (8 species)
    not a true protein
  7. 2391859Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries)
  8. 2391868Domain d3lppb1: 3lpp B:30-297 [305850]
    Other proteins in same PDB: d3lppa2, d3lppa3, d3lppa4, d3lppa5, d3lppb2, d3lppb3, d3lppb4, d3lppc2, d3lppc3, d3lppc4, d3lppc5, d3lppd2, d3lppd3, d3lppd4
    automated match to d2qlya1
    complexed with bma, cl, ktl, man, nag, peg, trs

Details for d3lppb1

PDB Entry: 3lpp (more details), 2.15 Å

PDB Description: crystal complex of n-terminal sucrase-isomaltase with kotalanol
PDB Compounds: (B:) Sucrase-isomaltase

SCOPe Domain Sequences for d3lppb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lppb1 b.30.5.0 (B:30-297) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpnvlndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmttt
sigveaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkeftg
ptvsdtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiygig
eqvhkrfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsnam
eifiqptpivtyrvtggildfyillgdt

SCOPe Domain Coordinates for d3lppb1:

Click to download the PDB-style file with coordinates for d3lppb1.
(The format of our PDB-style files is described here.)

Timeline for d3lppb1: