Lineage for d1dxla1 (1dxl A:4-152,A:276-347)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 20781Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 20782Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 20948Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (9 proteins)
  6. 20953Protein Dihydrolipoamide dehydrogenase [51959] (6 species)
  7. 20964Species Garden pea (Pisum sativum) [TaxId:3888] [51965] (1 PDB entry)
  8. 20965Domain d1dxla1: 1dxl A:4-152,A:276-347 [30585]
    Other proteins in same PDB: d1dxla3, d1dxlb3, d1dxlc3, d1dxld3

Details for d1dxla1

PDB Entry: 1dxl (more details), 3.15 Å

PDB Description: Dihydrolipoamide dehydrogenase of glycine decarboxylase from Pisum Sativum

SCOP Domain Sequences for d1dxla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum)}
sdendvviigggpggyvaaikaaqlgfkttciekrgalggtclnvgcipskallhsshmy
heakhsfanhgvkvsnveidlaammgqkdkavsnltrgieglfkknkvtyvkgygkfvsp
seisvdtiegentvvkgkhiiiatgsdvkXgrtpftsglnldkigvetdklgrilvnerf
stnvsgvyaigdvipgpmlahkaeedgvacveylagkvghvd

SCOP Domain Coordinates for d1dxla1:

Click to download the PDB-style file with coordinates for d1dxla1.
(The format of our PDB-style files is described here.)

Timeline for d1dxla1: