| Class b: All beta proteins [48724] (178 folds) |
| Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily) sandwich; 10 strands in two sheets |
Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) ![]() |
| Family b.150.1.0: automated matches [310671] (1 protein) not a true family |
| Protein automated matches [310870] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries) |
| Domain d3lppa4: 3lpp A:761-898 [305848] Other proteins in same PDB: d3lppa1, d3lppa2, d3lppa3, d3lppa5, d3lppb1, d3lppb2, d3lppb3, d3lppc1, d3lppc2, d3lppc3, d3lppc5, d3lppd1, d3lppd2, d3lppd3 automated match to d2qlya4 complexed with bma, cl, ktl, man, nag, peg, trs |
PDB Entry: 3lpp (more details), 2.15 Å
SCOPe Domain Sequences for d3lppa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lppa4 b.150.1.0 (A:761-898) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdtiqngnyilytfsv
snntldivcthssyqegttlafqtvkilgltdsvtevrvaennqpmnahsnftydasnqv
lliadlklnlgrnfsvqw
Timeline for d3lppa4:
View in 3DDomains from same chain: (mouse over for more information) d3lppa1, d3lppa2, d3lppa3, d3lppa5 |