Lineage for d3lppa4 (3lpp A:761-898)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433829Fold b.150: Glycolsyl hydrolase family 31 C-terminal domain-like [117124] (1 superfamily)
    sandwich; 10 strands in two sheets
  4. 2433830Superfamily b.150.1: Glycolsyl hydrolase family 31 C-terminal domain [117125] (2 families) (S)
  5. 2433877Family b.150.1.0: automated matches [310671] (1 protein)
    not a true family
  6. 2433878Protein automated matches [310870] (1 species)
    not a true protein
  7. 2433879Species Human (Homo sapiens) [TaxId:9606] [311309] (8 PDB entries)
  8. 2433887Domain d3lppa4: 3lpp A:761-898 [305848]
    Other proteins in same PDB: d3lppa1, d3lppa2, d3lppa3, d3lppa5, d3lppb1, d3lppb2, d3lppb3, d3lppc1, d3lppc2, d3lppc3, d3lppc5, d3lppd1, d3lppd2, d3lppd3
    automated match to d2qlya4
    complexed with bma, cl, ktl, man, nag, peg, trs

Details for d3lppa4

PDB Entry: 3lpp (more details), 2.15 Å

PDB Description: crystal complex of n-terminal sucrase-isomaltase with kotalanol
PDB Compounds: (A:) Sucrase-isomaltase

SCOPe Domain Sequences for d3lppa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lppa4 b.150.1.0 (A:761-898) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gyiipiqepdvtttasrknplglivalgenntakgdffwddgetkdtiqngnyilytfsv
snntldivcthssyqegttlafqtvkilgltdsvtevrvaennqpmnahsnftydasnqv
lliadlklnlgrnfsvqw

SCOPe Domain Coordinates for d3lppa4:

Click to download the PDB-style file with coordinates for d3lppa4.
(The format of our PDB-style files is described here.)

Timeline for d3lppa4: