Class b: All beta proteins [48724] (177 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (34 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225771] (21 PDB entries) |
Domain d3lppa3: 3lpp A:679-760 [305847] Other proteins in same PDB: d3lppa1, d3lppa2, d3lppa4, d3lppa5, d3lppb1, d3lppb2, d3lppb4, d3lppc1, d3lppc2, d3lppc4, d3lppc5, d3lppd1, d3lppd2, d3lppd4 automated match to d2qlya3 complexed with bma, cl, ktl, nag, peg, trs |
PDB Entry: 3lpp (more details), 2.15 Å
SCOPe Domain Sequences for d3lppa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lppa3 b.71.1.0 (A:679-760) automated matches {Human (Homo sapiens) [TaxId: 9606]} tvarpvlhefyedtnswiedteflwgpallitpvlkqgadtvsayipdaiwydyesgakr pwrkqrvdmylpadkiglhlrg
Timeline for d3lppa3:
View in 3D Domains from same chain: (mouse over for more information) d3lppa1, d3lppa2, d3lppa4, d3lppa5 |