Lineage for d3lppa3 (3lpp A:679-760)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2077462Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2077463Protein automated matches [226835] (34 species)
    not a true protein
  7. 2077557Species Human (Homo sapiens) [TaxId:9606] [225771] (21 PDB entries)
  8. 2077583Domain d3lppa3: 3lpp A:679-760 [305847]
    Other proteins in same PDB: d3lppa1, d3lppa2, d3lppa4, d3lppa5, d3lppb1, d3lppb2, d3lppb4, d3lppc1, d3lppc2, d3lppc4, d3lppc5, d3lppd1, d3lppd2, d3lppd4
    automated match to d2qlya3
    complexed with bma, cl, ktl, nag, peg, trs

Details for d3lppa3

PDB Entry: 3lpp (more details), 2.15 Å

PDB Description: crystal complex of n-terminal sucrase-isomaltase with kotalanol
PDB Compounds: (A:) Sucrase-isomaltase

SCOPe Domain Sequences for d3lppa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lppa3 b.71.1.0 (A:679-760) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvarpvlhefyedtnswiedteflwgpallitpvlkqgadtvsayipdaiwydyesgakr
pwrkqrvdmylpadkiglhlrg

SCOPe Domain Coordinates for d3lppa3:

Click to download the PDB-style file with coordinates for d3lppa3.
(The format of our PDB-style files is described here.)

Timeline for d3lppa3: