Lineage for d3lppa2 (3lpp A:298-678)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2441004Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2441005Protein automated matches [190075] (125 species)
    not a true protein
  7. 2441474Species Human (Homo sapiens) [TaxId:9606] [226772] (2 PDB entries)
  8. 2441477Domain d3lppa2: 3lpp A:298-678 [305846]
    Other proteins in same PDB: d3lppa1, d3lppa3, d3lppa4, d3lppa5, d3lppb1, d3lppb3, d3lppb4, d3lppc1, d3lppc3, d3lppc4, d3lppc5, d3lppd1, d3lppd3, d3lppd4
    automated match to d2qlya2
    complexed with bma, cl, ktl, man, nag, peg, trs

Details for d3lppa2

PDB Entry: 3lpp (more details), 2.15 Å

PDB Description: crystal complex of n-terminal sucrase-isomaltase with kotalanol
PDB Compounds: (A:) Sucrase-isomaltase

SCOPe Domain Sequences for d3lppa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lppa2 c.1.8.0 (A:298-678) automated matches {Human (Homo sapiens) [TaxId: 9606]}
peqvvqqyqqlvglpampaywnlgfqlsrwnyksldvvkevvrrnreagipfdtqvtdid
ymedkkdftydqvafnglpqfvqdlhdhgqkyviildpaisigrrangttyatyergntq
hvwinesdgstpiigevwpgltvypdftnpncidwwanecsifhqevqydglwidmnevs
sfiqgstkgcnvnklnyppftpdildklmyskticmdavqnwgkqydvhslygysmaiat
eqavqkvfpnkrsfiltrstfagsgrhaahwlgdntasweqmewsitgmlefslfgiplv
gadicgfvaetteelcrrwmqlgafypfsrnhnsdgyehqdpaffgqnsllvkssrqylt
irytllpflytlfykahvfge

SCOPe Domain Coordinates for d3lppa2:

Click to download the PDB-style file with coordinates for d3lppa2.
(The format of our PDB-style files is described here.)

Timeline for d3lppa2: