![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
![]() | Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
![]() | Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
![]() | Protein automated matches [226849] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [311307] (8 PDB entries) |
![]() | Domain d3lppa1: 3lpp A:29-297 [305845] Other proteins in same PDB: d3lppa2, d3lppa3, d3lppa4, d3lppa5, d3lppb2, d3lppb3, d3lppb4, d3lppc2, d3lppc3, d3lppc4, d3lppc5, d3lppd2, d3lppd3, d3lppd4 automated match to d2qlya1 complexed with bma, cl, ktl, nag, peg, trs |
PDB Entry: 3lpp (more details), 2.15 Å
SCOPe Domain Sequences for d3lppa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lppa1 b.30.5.0 (A:29-297) automated matches {Human (Homo sapiens) [TaxId: 9606]} kcpnvlndpvnvrincipeqfptegicaqrgccwrpwndslipwcffvdnhgynvqdmtt tsigveaklnripsptlfgndinsvlfttqnqtpnrfrfkitdpnnrryevphqyvkeft gptvsdtlydvkvaqnpfsiqvirksngktlfdtsigplvysdqylqisarlpsdyiygi geqvhkrfrhdlswktwpiftrdqlpgdnnnnlyghqtffmciedtsgksfgvflmnsna meifiqptpivtyrvtggildfyillgdt
Timeline for d3lppa1:
![]() Domains from same chain: (mouse over for more information) d3lppa2, d3lppa3, d3lppa4, d3lppa5 |