| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries) |
| Domain d3lpgb2: 3lpg B:182-273 [305842] Other proteins in same PDB: d3lpga1, d3lpga3, d3lpga4, d3lpgb1, d3lpgb3, d3lpgb4 automated match to d5czkb2 complexed with z78 |
PDB Entry: 3lpg (more details), 2.43 Å
SCOPe Domain Sequences for d3lpgb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpgb2 b.1.4.0 (B:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs
Timeline for d3lpgb2:
View in 3DDomains from other chains: (mouse over for more information) d3lpga1, d3lpga2, d3lpga3, d3lpga4 |