| Class b: All beta proteins [48724] (180 folds) |
| Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
| Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
| Protein automated matches [190770] (51 species) not a true protein |
| Species Escherichia coli [TaxId:83333] [272122] (17 PDB entries) |
| Domain d3lpgb1: 3lpg B:1-181 [305841] Other proteins in same PDB: d3lpga2, d3lpga3, d3lpga4, d3lpgb2, d3lpgb3, d3lpgb4 automated match to d5czkb1 complexed with z78 |
PDB Entry: 3lpg (more details), 2.43 Å
SCOPe Domain Sequences for d3lpgb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lpgb1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n
Timeline for d3lpgb1:
View in 3DDomains from other chains: (mouse over for more information) d3lpga1, d3lpga2, d3lpga3, d3lpga4 |