Lineage for d1bhya2 (1bhy A:276-400)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109341Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2109342Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2109874Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2109893Protein Dihydrolipoamide dehydrogenase [51959] (8 species)
  7. 2109916Species Neisseria meningitidis [TaxId:487] [51964] (2 PDB entries)
  8. 2109920Domain d1bhya2: 1bhy A:276-400 [30584]
    Other proteins in same PDB: d1bhya3
    complexed with fad

Details for d1bhya2

PDB Entry: 1bhy (more details), 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data
PDB Compounds: (A:) p64k

SCOPe Domain Sequences for d1bhya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhya2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]}
vtklpfipedpriidssgalalkevpgklliigggiiglemgtvystlgsrldvvemmdg
lmqgadrdlvkvwqkqneyrfdnimvntktvavepkedgvyvtfeganapkepqrydavl
vaagr

SCOPe Domain Coordinates for d1bhya2:

Click to download the PDB-style file with coordinates for d1bhya2.
(The format of our PDB-style files is described here.)

Timeline for d1bhya2: