Lineage for d3lpga3 (3lpg A:274-601)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419065Species Escherichia coli [TaxId:83333] [272137] (10 PDB entries)
  8. 2419078Domain d3lpga3: 3lpg A:274-601 [305839]
    Other proteins in same PDB: d3lpga1, d3lpga2, d3lpga4, d3lpgb1, d3lpgb2, d3lpgb4
    automated match to d5czkb3
    complexed with z78

Details for d3lpga3

PDB Entry: 3lpg (more details), 2.43 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1, 2-dihydroquinolin-3-yl)methyl)urea
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d3lpga3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpga3 c.1.8.0 (A:274-601) automated matches {Escherichia coli [TaxId: 83333]}
vavkgeqflinhkpfyftgfgrhedadlrgkgfdnvlmvhdhalmdwigansyrtshypy
aeemldwadehgivvidetaavgfnlslgigfeagnkpkelyseeavngetqqahlqaik
eliardknhpsvvmwsianepdtrpqgareyfaplaeatrkldptrpitcvnvmfcdaht
dtisdlfdvlclnryygwyvqsgdletaekvlekellawqeklhqpiiiteygvdtlagl
hsmytdmwseeyqcawldmyhrvfdrvsavvgeqvwnfadfatsqgilrvggnkkgiftr
drkpksaafllqkrwtgmnfgekpqqgg

SCOPe Domain Coordinates for d3lpga3:

Click to download the PDB-style file with coordinates for d3lpga3.
(The format of our PDB-style files is described here.)

Timeline for d3lpga3: