Lineage for d3lpga2 (3lpg A:182-273)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2762430Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) (S)
  5. 2762928Family b.1.4.0: automated matches [254272] (1 protein)
    not a true family
  6. 2762929Protein automated matches [254633] (19 species)
    not a true protein
  7. 2763159Species Escherichia coli [TaxId:83333] [272134] (17 PDB entries)
  8. 2763223Domain d3lpga2: 3lpg A:182-273 [305838]
    Other proteins in same PDB: d3lpga1, d3lpga3, d3lpga4, d3lpgb1, d3lpgb3, d3lpgb4
    automated match to d5czkb2
    complexed with z78

Details for d3lpga2

PDB Entry: 3lpg (more details), 2.43 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1, 2-dihydroquinolin-3-yl)methyl)urea
PDB Compounds: (A:) beta-glucuronidase

SCOPe Domain Sequences for d3lpga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpga2 b.1.4.0 (A:182-273) automated matches {Escherichia coli [TaxId: 83333]}
twvdditvvthvaqdcnhasvdwqvvangdvsvelrdadqqvvatgqgtsgtlqvvnphl
wqpgegylyelcvtaksqtecdiyplrvgirs

SCOPe Domain Coordinates for d3lpga2:

Click to download the PDB-style file with coordinates for d3lpga2.
(The format of our PDB-style files is described here.)

Timeline for d3lpga2: