Lineage for d3lpfb1 (3lpf B:1-181)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2369590Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2369591Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2370433Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2370434Protein automated matches [190770] (38 species)
    not a true protein
  7. 2370602Species Escherichia coli [TaxId:83333] [272122] (8 PDB entries)
  8. 2370610Domain d3lpfb1: 3lpf B:1-181 [305833]
    Other proteins in same PDB: d3lpfa2, d3lpfa3, d3lpfa4, d3lpfb2, d3lpfb3, d3lpfb4
    automated match to d5czkb1
    complexed with z77

Details for d3lpfb1

PDB Entry: 3lpf (more details), 2.26 Å

PDB Description: structure of e. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1- (2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea
PDB Compounds: (B:) beta-glucuronidase

SCOPe Domain Sequences for d3lpfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lpfb1 b.18.1.0 (B:1-181) automated matches {Escherichia coli [TaxId: 83333]}
mlrpvetptreikkldglwafsldrencgidqrwwesalqesraiavpgsfndqfadadi
rnyagnvwyqrevfipkgwagqrivlrfdavthygkvwvnnqevmehqggytpfeadvtp
yviagksvritvcvnnelnwqtippgmvitdengkkkqsyfhdffnyagihrsvmlyttp
n

SCOPe Domain Coordinates for d3lpfb1:

Click to download the PDB-style file with coordinates for d3lpfb1.
(The format of our PDB-style files is described here.)

Timeline for d3lpfb1: