Lineage for d1bhy_1 (1bhy 117-275,401-470)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 119015Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
  4. 119016Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families) (S)
  5. 119206Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (10 proteins)
  6. 119214Protein Dihydrolipoamide dehydrogenase [51959] (7 species)
  7. 119239Species Neisseria meningitidis [TaxId:487] [51964] (2 PDB entries)
  8. 119242Domain d1bhy_1: 1bhy 117-275,401-470 [30583]
    Other proteins in same PDB: d1bhy_3

Details for d1bhy_1

PDB Entry: 1bhy (more details), 4.18 Å

PDB Description: low temperature middle resolution structure of p64k from masc data

SCOP Domain Sequences for d1bhy_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bhy_1 c.3.1.5 (117-275,401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis}
gsadaeydvvvlgggpggysaafaaadeglkvaiveryktlggvclnvgcipskallhna
avidevrhlaangikypepeldidmlraykdgvvsrltgglagmaksrkvdviqgdgqfl
dphhlevsltagdayeqaaptgekkivafknciiaagsrXapngklisaekagvavtdrg
fievdkqmrtnvphiyaigdivgqpmlahkavheghvaaencaghkayfd

SCOP Domain Coordinates for d1bhy_1:

Click to download the PDB-style file with coordinates for d1bhy_1.
(The format of our PDB-style files is described here.)

Timeline for d1bhy_1: