SCOPe 2.07: Domain d3llxa2: 3llx A:19-256

Lineage for d3llxa2 (3llx A:19-256)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.6: PLP-binding barrel [51419] (2 families)
   circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand

5. Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (4 proteins)

6. Protein D-serine dehydratase [310801] (2 species)

7. Species Idiomarina loihiensis [TaxId:283942] [311065] (1 PDB entry)

8. Domain d3llxa2: 3llx A:19-256 [305820]
   Other proteins in same PDB: d3llxa1
   complexed with cl, edo, trs, zn

Details for d3llxa2

PDB Entry: 3llx, 1.5 Å

PDB Description: crystal structure of an ala racemase-like protein (il1761) from idiomarina loihiensis at 1.50 a resolution

PDB Compounds: (A:) Predicted amino acid aldolase or racemase

SCOPe Domain Sequences for d3llxa2:

Sequence; same for both SEQRES and ATOM records:

>d3llxa2 c.1.6.1 (A:19-256) D-serine dehydratase {Idiomarina loihiensis [TaxId: 283942]}
deaklksninylkqrveslgshlrphlktlrtleaagylldsksapatvstlaeaeayak
agytdllyavgiapaklkrvaalrqqginlhilldnitqaqavvdyaaefgqdfsvfiei
dsddhrggikpsdsklltiaktlgehftglmthaggsyacnteqglknfakqecdavria
rnnletagihcaitsvgstptahfgedfsdisevragvyttfdlvmknigvcdfshia

Timeline for d3llxa2:

• d3llxa2 first appeared in SCOPe 2.06
  
• d3llxa2 appears in the current release, SCOPe 2.08